PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG034501t1
Common NameTCM_034501
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family MIKC_MADS
Protein Properties Length: 228aa    MW: 25504.2 Da    PI: 7.9483
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG034501t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.73.1e-281059251
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      +i+n + rqvtfskRr g++KKAeELSvLCdaeva+iifs tgkl+ey+s
  Thecc1EG034501t1 10 KIDNVTARQVTFSKRRRGLFKKAEELSVLCDAEVALIIFSATGKLFEYAS 59
                      69**********************************************86 PP

2K-box462.3e-16871701598
             K-box  15 eslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                       +  + ++ +L ke +   +++R++ GedL+ L++ eLqqLe+ Le +l+++ ++K e + ++i+ l +k  +l eenk+L++k+
  Thecc1EG034501t1  87 QLENSNHIRLSKEFSVKSHQLRQMRGEDLQGLNIDELQQLEKMLEAGLTRVLETKGERISSEISALERKGVQLLEENKQLKQKM 170
                       55566677888888888899**************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.0E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.151161IPR002100Transcription factor, MADS-box
CDDcd002651.91E-38275No hitNo description
PRINTSPR004046.0E-27323IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.84E-31381IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.5E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.61286176IPR002487Transcription factor, K-box
PfamPF014863.8E-1591170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009908Biological Processflower development
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MAREKIKIRK IDNVTARQVT FSKRRRGLFK KAEELSVLCD AEVALIIFSA TGKLFEYASS  60
SMRDILGRYN VHSNNLNKLD QPSLELQLEN SNHIRLSKEF SVKSHQLRQM RGEDLQGLNI  120
DELQQLEKML EAGLTRVLET KGERISSEIS ALERKGVQLL EENKQLKQKM VTLCKGKRPI  180
LAESDAAVQE EGMSSESVTN VYSCSSGPPL EDDSSDTSLK LGLPFSC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P7e-20173173Myocyte-specific enhancer factor 2B
1tqe_Q7e-20173173Myocyte-specific enhancer factor 2B
1tqe_R7e-20173173Myocyte-specific enhancer factor 2B
1tqe_S7e-20173173Myocyte-specific enhancer factor 2B
3mu6_A6e-20272171Myocyte-specific enhancer factor 2A
3mu6_B6e-20272171Myocyte-specific enhancer factor 2A
3mu6_C6e-20272171Myocyte-specific enhancer factor 2A
3mu6_D6e-20272171Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007018219.11e-165K-box region and MADS-box transcription factor family protein
SwissprotQ9FVC11e-102SVP_ARATH; MADS-box protein SVP
TrEMBLA0A061FLR31e-165A0A061FLR3_THECC; K-box region and MADS-box transcription factor family protein
STRINGVIT_18s0001g07460.t011e-126(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41902747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-104MIKC_MADS family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]